Efeitos secundários mínimos do realce do músculo do halterofilismo dos Peptides do crescimento CJC-1295 com DAC

Detalhes do produto:
Lugar de origem: China
Marca: FILTER
Certificação: GMP
Número do modelo: 863288-34-0
Condições de Pagamento e Envio:
Quantidade de ordem mínima: 10 tubos de ensaio
Preço: Negotiable
Detalhes da embalagem: 5mg/vial, 10mg/vial ou como necessário
Tempo de entrega: dentro de 7 dias úteis
Termos de pagamento: L/C, T/T, Western Union, MoneyGram, Alipay
Habilidade da fonte: 100000vials/month

Informação detalhada

Especificação: 2mg/vial Aparência: pó branco
DeliveryTime: dentro de 7 dias úteis Porta: Shanghai/Guangzhou/Hong Kong
Pacote: Icebag, maneiras discretos da embalagem para sua referência LimitNum: 10 tubos de ensaio
Pureza: 99% Transporte: DHL, Fedix, HKEMS, HKEUB, TNT
Armazenamento: lugar seco, escuro e ventilado
Realçar:

growth hormone peptides

,

human growth hormone supplements

Descrição de produto

Peptide Cjc-1295 do halterofilismo 2/5/10mg/Vial com Dac CAS 863288-34-0

 

Descrição

Nome do produto:

CJC1295

Sinônimos:

CJC1295; Y (d - A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl) - 1-oxopropyl] - L-lysinamide; Acetato CJC-1295; CJC1295 com para fora o DAC

CAS:

863288-34-0

MF:

C159H258N46O45

MW:

0

EINECS:

 

Categorias de produto:

Peptides

 

 

Que deve ser observado?
1. Desde que CJC-1295 é apenas um peptide e não um esteroide, tem efeitos secundários muito mínimos. Os povos que usam doses altas deste peptide podem experimentar efeitos secundários suaves como sonhos longos que podem recordar claramente, mãos e dedos que vão dores insensibilizados, maçantes nas junções, e fraqueza assim como atordoamento se bastante hidratos de carbono não são consumidos.
2. Um outro efeito secundário do CJC-1295 é acromegalia, desde que ajuda em aumentar os níveis da hormona. A acromegalia é uma circunstância onde a hormona de crescimento extra seja liberada mesmo depois que os órgãos internos e o esqueleto terminaram o crescimento. Isto causa o engrossamento da pele, o aprofundamento da voz, a ampliação das maxilas, e slurring do discurso. Um outro efeito da acromegalia é o inchamento do tecido macio nos órgãos internos. Isto podia conduzir ao enfraquecimento dos músculos dos órgãos internos, como o coração. Isto foi testado durante os testes da fase 2 de CJC-1295.

 

Nosso processo:
O processo do controle da qualidade
1) Comprar
Os estudos de mercado completos, compreendem o preço das matérias primas e do desempenho. À fonte da obtenção a compreender inteiramente, e para garantir inteiramente a qualidade da obtenção das matérias primas.
2) Inspeção
Quatro etapas: amostra, pré-tratamento da amostra, medição e processo de dados.
3) Produção
a) cada operador deve fazer a auto-inspeção dos producs e fazer um registro correspondentes inspeção.
b) os inspetores a tempo completo verificam completamente a auto-inspeção do operador, e a revisão e assinam dentro o registro correspondente. A inspeção a tempo completo é responsável para a inspeção do produto acabado, e faz um registro ao produto acabado entrantes inspeção.
4) Antes de vender
O resultado da análise pode ser fornecido antes de vender.
É permitida à instituição da terceira da detecção se você não é satisfeito com os resultados da análise.


Nossas vantagens:
1. qualidade:
Nossa empresa é uma produção profissional de intermediários da hormona por muitos anos, nossos produtos exportaram para Alemanha, Espanha, Reino Unido, EUA, Austrália, Médio Oriente, e assim por diante o outro país, e nós obtivemos o feedback muito bom de nossos clientes, você podemos confiar-nos.
E nós somos o manufactory, tão nenhum problema para que nós controlem a qualidade.
2. método do pagamento: Western Union, TT.
3. serviço: O melhor serviço com serviço pós-venda a todos os clientes.
4. entrega:
Ordem da amostra: O pacote será enviado com o 3days após o pagamento. Nós podemos enviá-lo através de ACIMA, EMS, HK arejamos o cargo, o DHL ou o othermethod. Nós temos uma logística profissional e estável, e nós podemos entregar o pacote lisamente ao redor 3 a 5 dias.
O outro Peptide nossa fonte do laboratório:

Efeitos secundários mínimos do realce do músculo do halterofilismo dos Peptides do crescimento CJC-1295 com DAC 0

 

Efeitos secundários mínimos do realce do músculo do halterofilismo dos Peptides do crescimento CJC-1295 com DAC 1
 

Entre em contato conosco

Incorpore sua mensagem

Você pode estar nesses